DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Gzmm

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_476531.1 Gene:Gzmm / 29252 RGDID:620022 Length:264 Species:Rattus norvegicus


Alignment Length:236 Identity:73/236 - (30%)
Similarity:120/236 - (50%) Gaps:18/236 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYW 90
            :.:.:|:||......|.|:.:|||.:.||.|||.:.....::||||||   |..:.|::......
  Rat    22 RFEAQIIGGREAVPHSRPYMVSLQNTKSHVCGGVLVHQKWVLTAAHCL---SEPLQQLKLVFGLH 83

  Fly    91 S-----SGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGL---ASSNPANGAA 147
            |     ..|:||.:.....|.|||.. ..||:|::|::|.:..|..:|.:.|   ....||.|:.
  Rat    84 SLHDPQDPGLTFYIKQAIKHPGYNLK-YENDLALLKLDGRVKPSKNVKPLALPRKPRDKPAEGSR 147

  Fly   148 ASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMIC--AAASGKDACQGDS 210
            .|.:||| :::....:...||.:::.::....|.:|.: :...:..:|:|  |.|.|:..|:|||
  Rat   148 CSTAGWG-ITHQRGQLAKSLQELDLRLLDTRMCNNSRF-WNGVLTDSMLCLKAGAKGQAPCKGDS 210

  Fly   211 GGPLVSG-GVLVGVVSW-GYGCAYSNYPGVYADVAALRSWV 249
            |||||.| |.:.|::|: ...|.....|.|...||...||:
  Rat   211 GGPLVCGKGKVDGILSFSSKNCTDIFKPTVATAVAPYSSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 72/230 (31%)
GzmmNP_476531.1 Tryp_SPc 27..254 CDD:238113 73/231 (32%)
Trypsin 27..251 CDD:278516 72/229 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.