DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Hpn

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_038958880.1 Gene:Hpn / 29135 RGDID:61982 Length:559 Species:Rattus norvegicus


Alignment Length:244 Identity:91/244 - (37%)
Similarity:133/244 - (54%) Gaps:29/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCL--QSVSASVLQIRAGS-SYWS 91
            |||||..:::..:|||:||:..|:|.||||:.|.:.::|||||.  ::...|..::.||: :..|
  Rat   203 RIVGGQDSSLGRWPWQVSLRYDGTHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVARTS 267

  Fly    92 SGGVTFSVSSFKNHEGY--------NANTMVNDIAIIKINGALTFSSTIKAIGLASSNPA--NGA 146
            ...|...|.:...|.||        :.|:  ||||::.::.:|..:..|:.:.|.::..|  :|.
  Rat   268 PHAVQLGVQAVIYHGGYLPFRDPTIDENS--NDIALVHLSSSLPLTEYIQPVCLPAAGQALVDGK 330

  Fly   147 AASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA--ASGKDACQG 208
            ..:|:||| |..||..::  .||...|.|:|...|.|..: ||:||:..|.||.  ..|.|||||
  Rat   331 VCTVTGWGNTQFYGQQAV--VLQEARVPIISNEVCNSPDF-YGNQIKPKMFCAGYPEGGIDACQG 392

  Fly   209 DSGGPLV--------SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |||||.|        |...|.|:||||.|||.:..||||..|...|.|:
  Rat   393 DSGGPFVCEDRISGTSRWRLCGIVSWGTGCALARKPGVYTKVIDFREWI 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 90/242 (37%)
HpnXP_038958880.1 Hepsin-SRCR 92..200 CDD:401275
Tryp_SPc 204..441 CDD:238113 89/241 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.