DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Tmprss7

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001099352.2 Gene:Tmprss7 / 288118 RGDID:1304655 Length:829 Species:Rattus norvegicus


Alignment Length:244 Identity:87/244 - (35%)
Similarity:122/244 - (50%) Gaps:37/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSS-- 92
            |:||||.:...::|||:||...||..||.|:.|...:::||||......|      ..:.|::  
  Rat   591 RVVGGSDSQEGTWPWQVSLHFVGSAHCGASVISREWLLSAAHCFHGNRLS------DPTPWTAHL 649

  Fly    93 -----GGVTFSVSSFKN---HEGYNANTMVNDIAIIKINGALTFSSTIK------AIGLASSNPA 143
                 |...| ||..:.   ||.||:.|...|||::::  ::.:..|::      .|........
  Rat   650 GMYVQGNAKF-VSPVRRIVVHEYYNSQTFDYDIALLQL--SIAWPETLRQLIQPICIPPVGQRVR 711

  Fly   144 NGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAA-SGK-DAC 206
            :|....|:|||......|.....||...|.::.|:.|. ||||.   |.|.|:||.. ||| |||
  Rat   712 SGEKCWVTGWGRRHEADSKGSPILQQAEVELIDQTVCV-STYGI---ITSRMLCAGVMSGKSDAC 772

  Fly   207 QGDSGGPL----VSGG--VLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            :|||||||    .|.|  :|.|:|||||||...|:||||..|:....|:
  Rat   773 KGDSGGPLSCRRKSDGKWILTGIVSWGYGCGRPNFPGVYTRVSNFVPWI 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 86/242 (36%)
Tmprss7NP_001099352.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..49
SEA 94..190 CDD:279699
CUB <257..345 CDD:238001
LDLa 470..504 CDD:238060
LDLa 545..580 CDD:238060
Tryp_SPc 591..821 CDD:214473 86/242 (36%)
Tryp_SPc 592..823 CDD:238113 86/243 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.