DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Prss38

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:250 Identity:79/250 - (31%)
Similarity:128/250 - (51%) Gaps:34/250 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHC------LQS----VSAS 79
            |.|.|:::||..|....:|||:|:..:|.|.|||||.::..::|||||      ||:    |..:
  Rat   108 PALHGKLLGGELTIDRKWPWQVSIHYAGFHVCGGSILNAYWVLTAAHCFAREKRLQTFDMYVGIT 172

  Fly    80 VLQIRAGSSYWSSGGVTFSVSSFKNHEGYNA-NTMVNDIAIIKINGALTFSSTIKAIGLASSN-P 142
            .|::....:.|      |.::....|..:.. :.:..|:|:::...|:.||..:..|.|.||| .
  Rat   173 NLEVANKHTQW------FEINQVIIHPTFEMFHPVGGDVALVQSKSAIVFSDYVLPICLPSSNLN 231

  Fly   143 ANGAAASVSGWGTLS----YGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA--AS 201
            .:..:...:|||.:|    .|...:.:||.     ::.:.|| ...||..|.:...|:||.  .:
  Rat   232 LSDLSCWTTGWGMVSPQGETGKDLLEAQLP-----LIPKFQC-QLLYGLTSYLLPEMLCAGDIKN 290

  Fly   202 GKDACQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVISN 252
            .|:.|:||||.|||    ...:.:|:||||.|||...||||:|:|:...:|:..|
  Rat   291 MKNVCEGDSGSPLVCKVNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLNWIRYN 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 74/240 (31%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 75/238 (32%)
Tryp_SPc 116..342 CDD:214473 74/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.