DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and LOC286960

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:252 Identity:92/252 - (36%)
Similarity:123/252 - (48%) Gaps:24/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVT 68
            |..|.:|||..:..          |.:||||........|:|:||....||.||||:.|...:::
  Rat     7 FAFLGAAVALPVND----------DDKIVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLS 61

  Fly    69 AAHCLQSVSASVLQIRAG--SSYWSSGGVTF-SVSSFKNHEGYNANTMVNDIAIIKINGALTFSS 130
            ||||.:    ..||:|.|  :.:...||..| .......|..||.:|:.|||.:||:......:|
  Rat    62 AAHCYK----RKLQVRLGEHNIHVLEGGEQFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNS 122

  Fly   131 TIKAIGLASSNPANGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRST 194
            .:..:.|..|..:..|...||||| |:|.| ...|:.||.:...::|.|.|..|   |..||.|.
  Rat   123 QVSTVSLPRSCASTDAQCLVSGWGNTVSIG-GKYPALLQCLEAPVLSASSCKKS---YPGQITSN 183

  Fly   195 MICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |.|..  ..|||:|.||||||:|..|.:.|:||||..||....||||..|....||:
  Rat   184 MFCLGFLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 85/224 (38%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 85/224 (38%)
Tryp_SPc 24..243 CDD:238113 86/225 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.