DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG33459

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:249 Identity:68/249 - (27%)
Similarity:103/249 - (41%) Gaps:42/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGG 94
            ||.||....:.|.||...|.......||||:.:|..::|||||:.....: |.:|.|...|:...
  Fly    37 RIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSEFVLTAAHCVMPTPKN-LTVRLGEYDWTRQM 100

  Fly    95 VT---------FSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPAN------ 144
            .:         :.|:....|..|. :....|||::|:|..:.::..|:.|.|..  |.|      
  Fly   101 DSINPKHRHREYMVTRIYTHPSYR-SIAAYDIALLKLNQTVEYTVAIRPICLVL--PENFHEWYW 162

  Fly   145 ----GAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASGKDA 205
                ....:::|||...  :..:...||..|:..:.:..|...   ||..:..|.|||.:|...|
  Fly   163 LVDSVEDFTLTGWGATK--TEPVSQVLQSANLTQIDRGTCHDR---YGHSVDHTHICAGSSKSFA 222

  Fly   206 CQGDSGGPLVSGGV--------LVGVVSWGYGCAYSNYPG--VYADVAALRSWV 249
            |.||||.||....|        .||:||.|    ..|..|  |:.:|.:...|:
  Fly   223 CVGDSGSPLAMKVVHNRRYIHAQVGIVSRG----PKNCDGVTVFTNVVSFTEWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 67/247 (27%)
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 67/247 (27%)
Tryp_SPc 38..272 CDD:238113 66/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.