DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Gzma

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_703198.1 Gene:Gzma / 266708 RGDID:628640 Length:261 Species:Rattus norvegicus


Alignment Length:231 Identity:64/231 - (27%)
Similarity:107/231 - (46%) Gaps:19/231 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VPEGLLPQLDG--RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVL 81
            :|||      |  ||:||......|.|:.:.|:......|.|::.:.|.::|||||:....:.|:
  Rat    21 IPEG------GCERIIGGDTVVPHSRPYMVLLKLKPDSICAGALIAKNWVLTAAHCIPGKKSEVI 79

  Fly    82 QIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGL--ASSNPAN 144
             :.|.|..........||.....:..::.:|...|:.::::....|.:..:..:.|  ...:...
  Rat    80 -LGAHSIKKEPEQQILSVKKAYPYPCFDKHTHEGDLQLLRLKKKATLNKNVAILHLPKKGDDVKP 143

  Fly   145 GAAASVSGWGTLSYGSSSIPSQ-LQYVNVNIVSQSQCASST-YGYGSQIRSTMICAA--ASGKDA 205
            |....|:|||  .:.:.|.||. |:.||:.::.:..|.... |.:...|...||||.  ..|||:
  Rat   144 GTRCHVAGWG--RFHNKSPPSDTLREVNITVIDRKICNDEKHYNFNPVIGLNMICAGNLRGGKDS 206

  Fly   206 CQGDSGGPLVSGGVLVGVVSWGY--GCAYSNYPGVY 239
            |.|||||||:..|:..|:.::|.  .|.....||:|
  Rat   207 CYGDSGGPLLCEGIFRGITAFGLEGRCGDPKGPGIY 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 60/218 (28%)
GzmaNP_703198.1 Tryp_SPc 28..253 CDD:214473 60/218 (28%)
Tryp_SPc 29..256 CDD:238113 59/217 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.