DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Gzmf

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_703196.2 Gene:Gzmf / 266704 RGDID:628603 Length:248 Species:Rattus norvegicus


Alignment Length:265 Identity:72/265 - (27%)
Similarity:110/265 - (41%) Gaps:34/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDG--RIVGGSATTISSFPWQIS---LQRSGSHS-CGGS 59
            ||..:||::.            |||...|  .|:||......|.|:...   ::..|:.| |||.
  Rat     1 MLPVLILMTI------------LLPLEAGAEEIIGGHEVKPHSRPYMAHVKFVKVDGNRSVCGGF 53

  Fly    60 IYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKN---HEGYNANTMVNDIAIIK 121
            :.....::|||||    :...:::..|:........|..:...|.   |..||....:|||.::|
  Rat    54 LVQDYFVLTAAHC----TGRSMKVILGAHNLHVQEKTQQIIPVKRAIPHPAYNREDHINDIMLLK 114

  Fly   122 INGALTFSSTIKAIGLASSNP--ANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASST 184
            :......:..::.:.|...|.  ..|....|:|||.:|...:...|:||...:.|....:|....
  Rat   115 LESKAKKTRAVRPLNLPRPNDMVKPGDVCRVAGWGQMSVDVTKRTSRLQEAKLIIQEDKECKKLF 179

  Fly   185 YGYGSQIRSTMICAAASGK--DACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRS 247
            :.|.   .:|.|||....|  .|.:||||||||......||||:|.....|:  ||:..|.....
  Rat   180 HHYS---ETTEICAGDPKKIQAAYKGDSGGPLVCENRAYGVVSYGKNGTISS--GVFTKVVYFLP 239

  Fly   248 WVISN 252
            |:..|
  Rat   240 WISRN 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 62/229 (27%)
GzmfNP_703196.2 Tryp_SPc 21..244 CDD:238113 63/231 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.