DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Tmprss5

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_695223.2 Gene:Tmprss5 / 266681 RGDID:628625 Length:445 Species:Rattus norvegicus


Alignment Length:259 Identity:94/259 - (36%)
Similarity:125/259 - (48%) Gaps:32/259 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQ 74
            ::.|:..|..|      |..|||||.|.....:|||.|:.....|:||.|:.:...:||||||:.
  Rat   193 SLKCSECGARP------LASRIVGGQAVASGRWPWQASVMLGSRHTCGASVLAPYWVVTAAHCMY 251

  Fly    75 SVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEG-----------YNANTMVNDIAIIKINGALTF 128
            |...|.|      |.|.......|.|:.:.|:|           |:|.....|:|::::...:.|
  Rat   252 SFRLSRL------SSWRVHAGLVSHSAVRQHQGTMVEKIIPHPLYSAQNHDYDVALLQLRTPINF 310

  Fly   129 SSTIKAIGLASSNP--ANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQI 191
            |.|:.|:.|.:...  ..|:...|||||......:.....||...|.::|...|.||.. |...:
  Rat   311 SDTVSAVCLPAKEQHFPQGSQCWVSGWGHTDPSHTHSSDTLQDTMVPLLSTDLCNSSCM-YSGAL 374

  Fly   192 RSTMICAA-ASGK-DACQGDSGGPLV--SGGV--LVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ...|:||. ..|: ||||||||||||  ||..  ||||||||.|||..|.|||||.||....|:
  Rat   375 THRMLCAGYLDGRADACQGDSGGPLVCPSGDTWHLVGVVSWGRGCAEPNRPGVYAKVAEFLDWI 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 89/237 (38%)
Tmprss5NP_695223.2 SRCR_2 106..203 CDD:406055 2/9 (22%)
Tryp_SPc 208..441 CDD:238113 89/238 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.