DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and PRSS33

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001372391.1 Gene:PRSS33 / 260429 HGNCID:30405 Length:280 Species:Homo sapiens


Alignment Length:279 Identity:91/279 - (32%)
Similarity:134/279 - (48%) Gaps:42/279 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPEGL------LPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSI 60
            |:.::||     .||....:|.      .|::..|||||.......:|||.|:|..|:|.||||:
Human     7 LQVLLLL-----VLGAAGTQGRKSAACGQPRMSSRIVGGRDGRDGEWPWQASIQHRGAHVCGGSL 66

  Fly    61 YSSNVIVTAAHCL--QSVSAS----VLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAI 119
            .:...::|||||.  :::.|.    :..:|.||:  |...::..|........|:.:....|:|:
Human    67 IAPQWVLTAAHCFPRRALPAEYRVRLGALRLGST--SPRTLSVPVRRVLLPPDYSEDGARGDLAL 129

  Fly   120 IKINGALTFSSTIKAIGL--ASSNPANGAAASVSGWGTLSYGSSSIP----SQLQYVNVNIVSQS 178
            :::...:..|:.::.:.|  ..:.|..|....|:|||:|..|   :|    ..||.|.|.::...
Human   130 LQLRRPVPLSARVQPVCLPVPGARPPPGTPCRVTGWGSLRPG---VPLPEWRPLQGVRVPLLDSR 191

  Fly   179 QCASSTYGYGSQIRST-------MICAA--ASGKDACQGDSGGPLV---SGG-VLVGVVSWGYGC 230
            .| ...|..|:.:...       .:||.  ...||||||||||||.   ||. |||||||||.||
Human   192 TC-DGLYHVGADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSWGKGC 255

  Fly   231 AYSNYPGVYADVAALRSWV 249
            |..|.||||..||....|:
Human   256 ALPNRPGVYTSVATYSPWI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 83/243 (34%)
PRSS33NP_001372391.1 Tryp_SPc 37..275 CDD:238113 83/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4288
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.