DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Klkb1

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_036857.2 Gene:Klkb1 / 25048 RGDID:67382 Length:638 Species:Rattus norvegicus


Alignment Length:249 Identity:87/249 - (34%)
Similarity:118/249 - (47%) Gaps:36/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QLDGRIVGGSATTISSFPWQISLQ---RSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGS 87
            :::.|||||:.:::..:|||:|||   .|.:|.|||||.....|:|||||...:..        .
  Rat   386 KINARIVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIPY--------P 442

  Fly    88 SYWSSGGVTFSVSSFKN------------HEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASS 140
            ..|...|...::|...|            |:.|..:....|||:||:...|.::...|.|.|.|.
  Rat   443 DVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPICLPSK 507

  Fly   141 NPANGAAAS--VSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA--A 200
            ...|....:  |:||| |...|.:.  :.||...:.:|...:|......|  .|...||||.  .
  Rat   508 ADTNTIYTNCWVTGWGYTKERGETQ--NILQKATIPLVPNEECQKKYRDY--VITKQMICAGYKE 568

  Fly   201 SGKDACQGDSGGPLV---SG-GVLVGVVSWGYGCAYSNYPGVYADVAALRSWVI 250
            .|.|||:||||||||   || ..|||:.|||.|||....||||..||....|::
  Rat   569 GGIDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWIL 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 86/242 (36%)
Klkb1NP_036857.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519
Tryp_SPc 390..621 CDD:214473 86/242 (36%)
Tryp_SPc 391..621 CDD:238113 85/241 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.