DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Cela2a

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_036685.1 Gene:Cela2a / 24332 RGDID:2548 Length:271 Species:Rattus norvegicus


Alignment Length:268 Identity:92/268 - (34%)
Similarity:143/268 - (53%) Gaps:19/268 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGS----HSCGGSIY 61
            |::.::|.:.||.||....|...:.....|:|||...:.:|:|||:|||...|    |:||||:.
  Rat     1 MIRTLLLSALVAGALSCGYPTYEVQHDVSRVVGGQEASPNSWPWQVSLQYLSSGKWHHTCGGSLV 65

  Fly    62 SSNVIVTAAHCL-QSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMV--NDIAIIKIN 123
            ::|.::|||||: .|.:..||..|...|...||.:...||....||.:||..:.  ||||::|:.
  Rat    66 ANNWVLTAAHCISNSRTYRVLLGRHSLSTSESGSLAVQVSKLVVHEKWNAQKLSNGNDIALVKLA 130

  Fly   124 GALTFSSTIKAIGL--ASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYG 186
            ..:..:|.|:...|  |.:...|.....|:|||.|....:: |..||...:.:|..:.|:|::: 
  Rat   131 SPVALTSKIQTACLPPAGTILPNNYPCYVTGWGRLQTNGAT-PDVLQQGRLLVVDYATCSSASW- 193

  Fly   187 YGSQIRSTMICAAASG-KDACQGDSGGPL---VSGG--VLVGVVSWG--YGCAYSNYPGVYADVA 243
            :||.:::.|:||...| ..:|.|||||||   .|.|  .:.|:||:|  .||.|...|.|:..|:
  Rat   194 WGSSVKTNMVCAGGDGVTSSCNGDSGGPLNCQASNGQWQVHGIVSFGSTLGCNYPRKPSVFTRVS 258

  Fly   244 ALRSWVIS 251
            ....|:.|
  Rat   259 NYIDWINS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 83/235 (35%)
Cela2aNP_036685.1 Tryp_SPc 30..264 CDD:214473 83/235 (35%)
Tryp_SPc 31..267 CDD:238113 84/238 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.