DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Tmprss11f

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_848845.1 Gene:Tmprss11f / 243083 MGIID:2442348 Length:439 Species:Mus musculus


Alignment Length:249 Identity:81/249 - (32%)
Similarity:116/249 - (46%) Gaps:46/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTI-SSFPWQISLQRSGS-HSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSS 92
            |||.|..|.: ..:|||.|||..|: |.||.::.|:..::|||||                :|.:
Mouse   206 RIVQGRETAMEGEWPWQASLQLIGAGHQCGATLISNTWLLTAAHC----------------FWKN 254

  Fly    93 GG-----VTF-----------SVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSN 141
            ..     |||           ||.....||.|:.:|..||||:.::...:.||:.::.:.|..|:
Mouse   255 RDPTKWIVTFGTTITPPLVKRSVGKIIIHEEYHRDTNENDIALAQLTTRVEFSNVVQRVCLPDSS 319

  Fly   142 ---PANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA-ASG 202
               |.. .:..|:|:|:: .......::|:...|..:....|..... |...|...|:||. ..|
Mouse   320 MKLPPK-TSVFVTGFGSI-VDDGPTQNKLRQARVETIGSDVCNRKDV-YDGLITPGMLCAGFMEG 381

  Fly   203 K-DACQGDSGGPLVSGG----VLVGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
            | |||:||||||||...    .:||:||||..||..|.||||..|...|.|:.|
Mouse   382 KIDACKGDSGGPLVYDNRDIWYIVGIVSWGQSCALPNKPGVYTRVTKYRDWIAS 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 79/245 (32%)
Tmprss11fNP_848845.1 SEA 60..164 CDD:396113
Tryp_SPc 207..436 CDD:238113 80/248 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.