DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Ctrb1

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_036668.1 Gene:Ctrb1 / 24291 RGDID:2444 Length:263 Species:Rattus norvegicus


Alignment Length:264 Identity:102/264 - (38%)
Similarity:138/264 - (52%) Gaps:24/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSA---VACALGGTVPEGLLPQLDG--RIVGGSATTISSFPWQISLQ-RSGSHSCGGSI 60
            :.|:.|:|.   |....|..||. :.|.|.|  |||.|......|:|||:||| ::|.|.||||:
  Rat     1 MAFLWLVSCFALVGATFGCGVPT-IQPVLTGLSRIVNGEDAIPGSWPWQVSLQDKTGFHFCGGSL 64

  Fly    61 YSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSV----SSFKNHEGYNANTMVNDIAIIK 121
            .|.:.:||||||....|..|:   ||.....|......|    ..|||.: :|..|:.|||.::|
  Rat    65 ISEDWVVTAAHCGVKTSDVVV---AGEFDQGSDEENIQVLKIAQVFKNPK-FNMFTVRNDITLLK 125

  Fly   122 INGALTFSSTIKAIGLASSNP--ANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASST 184
            :.....||.|:.|:.|.:.:.  ..|...:.:|||...|.:...|.:||...:.|||::.|..| 
  Rat   126 LATPAQFSETVSAVCLPNVDDDFPPGTVCATTGWGKTKYNALKTPEKLQQAALPIVSEADCKKS- 189

  Fly   185 YGYGSQIRSTMICAAASGKDACQGDSGGPLV--SGGV--LVGVVSWGYGCAYSNYPGVYADVAAL 245
              :||:|...|.||.|||..:|.||||||||  ..||  |.|:||||.|...::.|.||:.|.||
  Rat   190 --WGSKITDVMTCAGASGVSSCMGDSGGPLVCQKDGVWTLAGIVSWGSGVCSTSTPAVYSRVTAL 252

  Fly   246 RSWV 249
            ..||
  Rat   253 MPWV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 90/229 (39%)
Ctrb1NP_036668.1 Tryp_SPc 33..256 CDD:214473 90/229 (39%)
Tryp_SPc 34..259 CDD:238113 91/230 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.