DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Prss42

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_694739.1 Gene:Prss42 / 235628 MGIID:2665280 Length:335 Species:Mus musculus


Alignment Length:235 Identity:80/235 - (34%)
Similarity:126/235 - (53%) Gaps:13/235 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGG 94
            :|:||.......:|||:|::....|.||||:.:|..::|||||:.|.....:::...|.|..:..
Mouse    78 KIMGGVDAEEGKWPWQVSVRVRHMHVCGGSLINSQWVLTAAHCIYSRIQYNVKVGDRSVYRQNTS 142

  Fly    95 VTFSVSSFKNHEGYNANTMV-NDIAIIKINGALTFSSTIKAIGLAS-SNPAN-GAAASVSGWGTL 156
            :...:.:...|..::...:| ||||::|:...:.|::.|..:.:.| |.|.. |....|:|||.|
Mouse   143 LVIPIKTIFVHPKFSTTIVVKNDIALLKLQHPVNFTTNIYPVCIPSESFPVKAGTKCWVTGWGKL 207

  Fly   157 SYGSSSIPSQ-LQYVNVNIVSQSQC----ASSTYGYGSQIRSTMICA-AASGKDACQGDSGGPL- 214
            ..|:..:|:: ||.|:.|::...:|    ..:|......::..|:|. ...||||||||||||: 
Mouse   208 VPGAPDVPTEILQEVDQNVILYEECNEMLKKATSSSVDLVKRGMVCGYKERGKDACQGDSGGPMS 272

  Fly   215 ---VSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
               .:..|.|||||||..|....|||||.|||....|:|:
Mouse   273 CEFENKWVQVGVVSWGISCGRKGYPGVYTDVAFYSKWLIA 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 78/231 (34%)
Prss42NP_694739.1 Tryp_SPc 78..309 CDD:214473 78/230 (34%)
Tryp_SPc 79..310 CDD:238113 78/230 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.