DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and TPSD1

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:235 Identity:74/235 - (31%)
Similarity:110/235 - (46%) Gaps:26/235 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVP-EGLLPQLDGRIVGGSATTISSFPWQISLQRSG---SHSCGGSIY 61
            ||..::|...|..:.....| .|...|..| ||||.....|.:|||:||:..|   .|.||||:.
Human     8 MLSLLLLALPVLASPAYVAPAPGQALQQTG-IVGGQEAPRSKWPWQVSLRVRGPYWMHFCGGSLI 71

  Fly    62 SSNVIVTAAHC----LQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKI 122
            ....::|||||    ::.::|..:|:|....|:..  ....||....|..:.......|||::::
Human    72 HPQWVLTAAHCVEPDIKDLAALRVQLREQHLYYQD--QLLPVSRIIVHPQFYIIQTGADIALLEL 134

  Fly   123 NGALTFSSTIKAIGL--ASSNPANGAAASVSGWGTLSYGSSSI----PSQLQYVNVNIVSQSQCA 181
            ...:..||.|..:.|  ||.....|....|:|||.:   .:::    |..|:.|.|.:|....|.
Human   135 EEPVNISSHIHTVTLPPASETFPPGMPCWVTGWGDV---DNNVHLPPPYPLKEVEVPVVENHLCN 196

  Fly   182 SSTY-----GYGSQI-RSTMICAAASGKDACQGDSGGPLV 215
            :..:     |:..|| |..|:||.:...|:||||||||||
Human   197 AEYHTGLHTGHSFQIVRDDMLCAGSENHDSCQGDSGGPLV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 66/205 (32%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 66/204 (32%)
Tryp_SPc 38..240 CDD:214473 66/204 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.