DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Tmprss11d

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_663536.1 Gene:Tmprss11d / 231382 MGIID:2385221 Length:417 Species:Mus musculus


Alignment Length:253 Identity:92/253 - (36%)
Similarity:140/253 - (55%) Gaps:34/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVL 81
            |..|: |:...:.||:||.......:|||:|||.:..|.|||::.|:..::|||||.:|.     
Mouse   173 GARPD-LITLSEERIIGGMQAEPGDWPWQVSLQLNNVHHCGGALISNMWVLTAAHCFKSY----- 231

  Fly    82 QIRAGSSYWSSGGVTFSVSSFK-----------NHEGYNANTMVNDIAIIKINGALTFSSTIKAI 135
               ....||::   ||.||:..           .|:||::.|..||||:::::.::.||..|..:
Mouse   232 ---PNPQYWTA---TFGVSTMSPRLRVRVRAILAHDGYSSVTRDNDIAVVQLDRSVAFSRNIHRV 290

  Fly   136 GL--ASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICA 198
            .|  |:.|...|:.|.|:|||:|:||.::: :.|:...|.|:|..:| ::..||...:...|:||
Mouse   291 CLPAATQNIIPGSVAYVTGWGSLTYGGNAV-TNLRQGEVRIISSEEC-NTPAGYSGSVLPGMLCA 353

  Fly   199 A--ASGKDACQGDSGGPLVSGG-----VLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            .  :...||||||||||||...     .:||:|||||.|...|.||||..|.|.|:|:
Mouse   354 GMRSGAVDACQGDSGGPLVQEDSRRLWFVVGIVSWGYQCGLPNKPGVYTRVTAYRNWI 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 88/238 (37%)
Tmprss11dNP_663536.1 SEA 48..140 CDD:279699
Tryp_SPc 185..411 CDD:214473 88/238 (37%)
Tryp_SPc 186..414 CDD:238113 88/239 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.