DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Try4

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_035776.1 Gene:Try4 / 22074 MGIID:102757 Length:246 Species:Mus musculus


Alignment Length:255 Identity:96/255 - (37%)
Similarity:143/255 - (56%) Gaps:23/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVI 66
            ::.::.|:.|..|:...|.:      |.:||||.....:|.|:|:|| .||.|.||||:.:...:
Mouse     1 MRALLFLALVGAAVAFPVDD------DDKIVGGYTCRENSVPYQVSL-NSGYHFCGGSLINDQWV 58

  Fly    67 VTAAHCLQSVSASVLQIRAGSSYWS--SGGVTFSVSSFK--NHEGYNANTMVNDIAIIKINGALT 127
            |:||||.:    |.:|:|.|....:  .|...| |:|.|  .|..:|:.|:.|||.:||:...:|
Mouse    59 VSAAHCYK----SRIQVRLGEHNINVLEGNEQF-VNSAKIIKHPNFNSRTLNNDIMLIKLASPVT 118

  Fly   128 FSSTIKAIGLASSNPANGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQI 191
            .::.:..:.|.||....|....:|||| |||:|.:: |..||.::..::.|:.|.:|   |..:|
Mouse   119 LNARVATVALPSSCAPAGTQCLISGWGNTLSFGVNN-PDLLQCLDAPLLPQADCEAS---YPGKI 179

  Fly   192 RSTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            .:.|||..  ..|||:||||||||:|..|.|.|:||||||||..:.||||..|.....|:
Mouse   180 TNNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 90/225 (40%)
Try4NP_035776.1 Tryp_SPc 23..239 CDD:214473 90/225 (40%)
Tryp_SPc 24..242 CDD:238113 91/226 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.