DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Prss2

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_033456.1 Gene:Prss2 / 22072 MGIID:102759 Length:246 Species:Mus musculus


Alignment Length:252 Identity:97/252 - (38%)
Similarity:139/252 - (55%) Gaps:23/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTA 69
            :::|:.|..|:...|.:      |.:||||.....||.|:|:|| .:|.|.||||:.:...:|:|
Mouse     4 LLILALVGAAVAFPVDD------DDKIVGGYTCRESSVPYQVSL-NAGYHFCGGSLINDQWVVSA 61

  Fly    70 AHCLQSVSASVLQIRAGSSYWS--SGGVTFSVSSFK--NHEGYNANTMVNDIAIIKINGALTFSS 130
            |||.:    ..:|:|.|....:  .|...| |.|.|  .|..||:.|:.|||.:||:...:|.::
Mouse    62 AHCYK----YRIQVRLGEHNINVLEGNEQF-VDSAKIIRHPNYNSWTLDNDIMLIKLASPVTLNA 121

  Fly   131 TIKAIGLASSNPANGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRST 194
            .:.::.|.||....|....:|||| |||.|.:: |..||.|:..::.|:.|.:|   |...|.:.
Mouse   122 RVASVPLPSSCAPAGTQCLISGWGNTLSNGVNN-PDLLQCVDAPVLPQADCEAS---YPGDITNN 182

  Fly   195 MICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |||..  ..|||:||||||||:|..|.|.|:||||||||..:.||||..|.....|:
Mouse   183 MICVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQPDAPGVYTKVCNYVDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 91/225 (40%)
Prss2NP_033456.1 Tryp_SPc 23..239 CDD:214473 91/225 (40%)
Tryp_SPc 24..242 CDD:238113 92/226 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.