DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Prss47

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006517555.1 Gene:Prss47 / 218304 MGIID:2685120 Length:370 Species:Mus musculus


Alignment Length:245 Identity:72/245 - (29%)
Similarity:125/245 - (51%) Gaps:21/245 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASV--LQIRAGS 87
            |::.|::.||..|....:|||.||...|.|.||..:..::.:.:.|||.::.|.:.  .::..|:
Mouse    68 PKMVGKVFGGQDTLAGQWPWQASLLYRGVHLCGAVLIDTHWLASTAHCFRNKSQAPEDYEVLLGN 132

  Fly    88 S--YWSSGGV-TFSVSSFKNHEGYNA-NTMVNDIAIIKINGALTFSSTIKAIGLASSNP--ANGA 146
            :  |..:... ..||:...:|..:.. ::..:|||:::::..:.|:|.:....|.|.:.  :|..
Mouse   133 NQLYQETKHTQKISVNHIVSHPDFEKFHSFGSDIAMLQLHLPINFTSYVVPACLPSKDTQLSNHT 197

  Fly   147 AASVSGWGTLSYGSSSIPS-QLQYVNVNIVSQSQCASSTYGY-----GSQIRSTMICAA--ASGK 203
            :..::|||.||..:..:|. .||...|.|:....| ::.||.     .:.:...|:||.  ::||
Mouse   198 SCWITGWGMLSEDTKLLPPFSLQEGEVGIIDNEFC-NALYGQTPGQSRNYVYEEMLCAGGLSTGK 261

  Fly   204 DACQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ..|:|||||||:    |..||||:.|||..|.:..||.|:..||....|:
Mouse   262 SICRGDSGGPLICYHNSTWVLVGLASWGLDCRHPIYPSVFTRVAYFTDWI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 69/238 (29%)
Prss47XP_006517555.1 Tryp_SPc 74..314 CDD:238113 70/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.