DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Prss38

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:260 Identity:82/260 - (31%)
Similarity:128/260 - (49%) Gaps:35/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQS- 75
            |.:|.|.|..| .|.|.|:::||.......:|||:||..||.|.|||||.|:..:::||||... 
Mouse    38 ANSLSGDVACG-QPVLQGKLLGGEFARDRKWPWQVSLHYSGFHICGGSILSAYWVLSAAHCFDRG 101

  Fly    76 ---------VSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNA-NTMVNDIAIIKINGALTFSS 130
                     |..:.|:.....:.|      |.:.....|..:.. :.:..|:|::::..|:.||.
Mouse   102 KKLETYDIYVGITNLEKANRHTQW------FEIYQVIIHPTFQMYHPIGGDVALVQLKSAIVFSD 160

  Fly   131 TIKAIGLASSN-PANGAAASVSGWGTLS----YGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQ 190
            .:..|.|..|: .....:...:|||.:|    .|:..:.:||.     ::.:.|| ...||..|.
Mouse   161 FVLPICLPPSDLYLINLSCWTTGWGMISPQGETGNELLEAQLP-----LIPRFQC-QLLYGLSSY 219

  Fly   191 IRSTMICAA--ASGKDACQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            :...|:|||  .:.|:.|:||||.|||    ...:.:|:||||.|||...||||:|:|:...||:
Mouse   220 LLPEMLCAADIKTMKNVCEGDSGSPLVCKQNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLSWI 284

  Fly   250  249
            Mouse   285  284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 73/240 (30%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 74/239 (31%)
Tryp_SPc 58..284 CDD:214473 73/237 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.