DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and F12

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_000496.2 Gene:F12 / 2161 HGNCID:3530 Length:615 Species:Homo sapiens


Alignment Length:241 Identity:77/241 - (31%)
Similarity:119/241 - (49%) Gaps:24/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHS-CGGSIYSSNVIVTAAHCLQSVSA----SVLQIRAGSSY 89
            |:|||......:.|:..:|.  ..|| |.||:.:...::|||||||...|    :|:..:...::
Human   372 RVVGGLVALRGAHPYIAALY--WGHSFCAGSLIAPCWVLTAAHCLQDRPAPEDLTVVLGQERRNH 434

  Fly    90 WSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKI-----NGALTFSSTIKAIGLAS--SNPANGAA 147
            ......|.:|.|::.||.::..:..:|:|::::     ......|..::.:.|.|  :.|:....
Human   435 SCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSPYVQPVCLPSGAARPSETTL 499

  Fly   148 ASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA--ASGKDACQGDS 210
            ..|:|||....|:....|.||...|..:|..:|::... :||.|...|:||.  ..|.|||||||
Human   500 CQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDV-HGSSILPGMLCAGFLEGGTDACQGDS 563

  Fly   211 GGPLVSGG-------VLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |||||...       .|.|::|||.||...|.||||.|||...:|:
Human   564 GGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWI 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 76/239 (32%)
F12NP_000496.2 FN2 41..88 CDD:128373
EGF_CA 96..131 CDD:238011
FN1 133..173 CDD:238018
EGF 178..206 CDD:278437
Kringle 217..295 CDD:278480
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..359
Tryp_SPc 372..609 CDD:214473 76/239 (32%)
Tryp_SPc 373..612 CDD:238113 76/240 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.