DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Tmprss4

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_663378.1 Gene:Tmprss4 / 214523 MGIID:2384877 Length:435 Species:Mus musculus


Alignment Length:230 Identity:80/230 - (34%)
Similarity:122/230 - (53%) Gaps:14/230 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQS-VSASVLQIRAGSSYWSSG 93
            |:|||....:.|:|||:|:|.:..|.|||||...:.|:|||||.:. :..|..::||||:...: 
Mouse   202 RVVGGVEAPVDSWPWQVSIQYNKQHVCGGSILDPHWILTAAHCFRKYLDVSSWKVRAGSNILGN- 265

  Fly    94 GVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSN----PANGAAASVSGWG 154
            ..:..|:.....|.........|||::|:...||||.:::.|.|..|:    ||  ....|.|||
Mouse   266 SPSLPVAKIFIAEPNPLYPKEKDIALVKLQMPLTFSGSVRPICLPFSDEVLVPA--TPVWVIGWG 328

  Fly   155 TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAA--SGKDACQGDSGGPLV-- 215
            ........:...|...:|.::..::| ::...|..::.:.|:||..  .|||.|||||||||:  
Mouse   329 FTEENGGKMSDMLLQASVQVIDSTRC-NAEDAYEGEVTAEMLCAGTPQGGKDTCQGDSGGPLMYH 392

  Fly   216 -SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
             ....:||:||||:||...:.||||..|.|..:|:
Mouse   393 SDKWQVVGIVSWGHGCGGPSTPGVYTKVTAYLNWI 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 79/228 (35%)
Tmprss4NP_663378.1 LDLa 56..90 CDD:238060
SRCR_2 106..195 CDD:295335
Tryp_SPc 202..427 CDD:214473 79/228 (35%)
Tryp_SPc 203..430 CDD:238113 79/229 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.