DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Proc

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006525784.1 Gene:Proc / 19123 MGIID:97771 Length:484 Species:Mus musculus


Alignment Length:249 Identity:78/249 - (31%)
Similarity:116/249 - (46%) Gaps:36/249 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DGRIVGGSATTISSFPWQ-ISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGS---- 87
            |.|||.|:.|.....||| |.|......:|||.:..::.::|||||::....  |.:|.|.    
Mouse   233 DPRIVNGTLTKQGDSPWQAILLDSKKKLACGGVLIHTSWVLTAAHCVEGTKK--LTVRLGEYDLR 295

  Fly    88 --SYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAI-----GLASSNPANG 145
              .:|.   :...:.....|..|..::..||||::::....|.|.||..|     |||......|
Mouse   296 RRDHWE---LDLDIKEILVHPNYTRSSSDNDIALLRLAQPATLSKTIVPICLPNNGLAQELTQAG 357

  Fly   146 AAASVSGWGTLSYGSSSIPSQ-------LQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASG- 202
            ....|:|||   |.|..|...       |.::.:.:|::::|........|:   .|:||...| 
Mouse   358 QETVVTGWG---YQSDRIKDGRRNRTFILTFIRIPLVARNECVEVMKNVVSE---NMLCAGIIGD 416

  Fly   203 -KDACQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
             :|||.||||||:|    ....|||:||||.||.::|..|:|..|.:...|:.|
Mouse   417 TRDACDGDSGGPMVVFFRGTWFLVGLVSWGEGCGHTNNYGIYTKVGSYLKWIHS 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 75/243 (31%)
ProcXP_006525784.1 GLA 50..110 CDD:214503
EGF_CA 111..155 CDD:238011
FXa_inhibition 163..198 CDD:373209
Tryp_SPc 236..470 CDD:238113 75/244 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.