DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Gzmb

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_612526.2 Gene:Gzmb / 171528 RGDID:620018 Length:248 Species:Rattus norvegicus


Alignment Length:275 Identity:78/275 - (28%)
Similarity:115/275 - (41%) Gaps:61/275 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPEGLLPQLD-GRIVGGSATTISSFPW----QISLQRSGSHSCGGSIY 61
            :|.::||.:.:          |.|:.: |.|:||......|.|:    ||..:.|||..|||.:.
  Rat     1 MKLLLLLLSFS----------LAPKTEAGEIIGGHEAKPHSRPYMAYLQIMDEYSGSKKCGGFLI 55

  Fly    62 SSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKN---------------HEGYNAN 111
            ..:.::|||||            :||..    .||....:.|.               |..||:.
  Rat    56 REDFVLTAAHC------------SGSKI----NVTLGAHNIKEQEKMQQIIPVVKIIPHPAYNSK 104

  Fly   112 TMVNDIAIIKINGALTFSSTIKAIGLASSN----PANGAAASVSGWGTLS-YGSSSIPSQLQYVN 171
            |:.|||.::|:......||.:|.:.|...|    |  |....|:|||.|. .|..|  ..||.|.
  Rat   105 TISNDIMLLKLKSKAKRSSAVKPLNLPRRNVKVKP--GDVCYVAGWGKLGPMGKYS--DTLQEVE 165

  Fly   172 VNIVSQSQCASSTYGYGSQIRSTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSN 234
            :.:....:|.|....|..  ::..|||.  ...:.:.:||||||||...|..|:||  ||....:
  Rat   166 LTVQEDQKCESYLKNYFD--KANEICAGDPKIKRASFRGDSGGPLVCKKVAAGIVS--YGQNDGS 226

  Fly   235 YPGVYADVAALRSWV 249
            .|..:..|:...||:
  Rat   227 TPRAFTKVSTFLSWI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 71/244 (29%)
GzmbNP_612526.2 Tryp_SPc 20..241 CDD:214473 71/244 (29%)
Tryp_SPc 21..244 CDD:238113 72/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.