DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CFD

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001304264.1 Gene:CFD / 1675 HGNCID:2771 Length:260 Species:Homo sapiens


Alignment Length:259 Identity:77/259 - (29%)
Similarity:135/259 - (52%) Gaps:17/259 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVAC---ALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSS 63
            |..::||.|.||   |.....|    |:  |||:||......:.|:..|:|.:|:|.|||.:.:.
Human     7 LAVLVLLGAAACGEEAWAWAAP----PR--GRILGGREAEAHARPYMASVQLNGAHLCGGVLVAE 65

  Fly    64 NVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVT---FSVSSFKNHEGYNANTMVNDIAIIKINGA 125
            ..:::|||||:..:...:|:..|:...|....:   :.|.....|.....:|:.:|:.:::::..
Human    66 QWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQLSEK 130

  Fly   126 LTFSSTIKAI--GLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYG 188
            .|....::.:  .....:.|.|....|:|||.:::.... |..||:|.:.::.::.|...|:..|
Human   131 ATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRR-PDSLQHVLLPVLDRATCNRRTHHDG 194

  Fly   189 SQIRSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYG-CAYSNYPGVYADVAALRSWVIS 251
            : |...::||.::.:|:|:||||||||.||||.|||:.|.. |.....||:|..||:..:|:.|
Human   195 A-ITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 65/224 (29%)
CFDNP_001304264.1 Tryp_SPc 32..255 CDD:214473 65/224 (29%)
Tryp_SPc 33..258 CDD:238113 66/227 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.