DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Klk1b1

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_034775.1 Gene:Klk1b1 / 16623 MGIID:892019 Length:261 Species:Mus musculus


Alignment Length:281 Identity:81/281 - (28%)
Similarity:121/281 - (43%) Gaps:65/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVT 68
            |:||.  :|.:|||.   ...|.:..|||||.....:|.||.:::.|...:.|||.:..:|.::|
Mouse     3 FLILF--LALSLGGI---DAAPPVQSRIVGGFKCEKNSQPWHVAVYRYKEYICGGVLLDANWVLT 62

  Fly    69 AAHCLQSVSASVLQIRAGSSYWSSGGVTFS---------------VSSFKNHEGYNANTMVN--- 115
            ||||                |:....|...               ||....|..||.:...|   
Mouse    63 AAHC----------------YYEKNNVWLGKNNLYQDEPSAQHRLVSKSFLHPCYNMSLHRNRIQ 111

  Fly   116 --------DIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQY--- 169
                    |:.:::::.....:..:|.|.|.:..|..|:....||||::      ||.:.||   
Mouse   112 NPQDDYSYDLMLLRLSKPADITDVVKPIALPTEEPKLGSTCLASGWGSI------IPVKFQYAKD 170

  Fly   170 ---VNVNIVSQSQCASSTYGYGSQIRSTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYG 229
               ||:.::....|..:   |..::...|:||.  ..|||.|:|||||||:..|||.|:.||||.
Mouse   171 LQCVNLKLLPNEDCDKA---YVQKVTDVMLCAGVKGGGKDTCKGDSGGPLICDGVLQGLTSWGYN 232

  Fly   230 -CAYSNYPGVYADVAALRSWV 249
             |.....||||..:....||:
Mouse   233 PCGEPKKPGVYTKLIKFTSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 72/253 (28%)
Klk1b1NP_034775.1 Tryp_SPc 24..253 CDD:214473 72/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.