DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Klk1b27

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_064664.1 Gene:Klk1b27 / 16619 MGIID:891980 Length:263 Species:Mus musculus


Alignment Length:270 Identity:79/270 - (29%)
Similarity:127/270 - (47%) Gaps:37/270 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVI 66
            ::|:||.  :|.:|||.   ...|.:..||:||.....:|.||.:::.||..:.|||.:...|.:
Mouse     1 MRFLILF--LALSLGGI---DAAPPVQSRIIGGFKCKKNSQPWHVAVLRSNKYICGGVLLDPNWV 60

  Fly    67 VTAAHCLQSVSASVLQIRAGSSYWSSGGVTFS---------VSSFKNHEGYNANTM--------- 113
            :|||||..:.::.       .:.|......|.         ||....|..||.:.:         
Mouse    61 LTAAHCYGNDTSQ-------HNVWLGKNKLFQREPSAQHRWVSKSFPHPDYNMSLLNDHIPHPED 118

  Fly   114 -VNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQ 177
             .||:.:::::.....:..:|.|.|.:..|..|:....||||:::.....||:.||.|.:.::..
Mouse   119 KSNDLMLLRLSKPADITDAVKPIDLPTEEPKLGSTCLASGWGSITPTKYQIPNDLQCVFIKLLPN 183

  Fly   178 SQCASSTYGYGSQIRSTMICA--AASGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVY 239
            ..||.:   |..::...|:|.  ...||..|:|||||||:..|||.|:.||| ..||..|.|||:
Mouse   184 ENCAKA---YVHKVTDVMLCVGETGGGKGTCKGDSGGPLICDGVLHGITSWGSIPCAKPNAPGVF 245

  Fly   240 ADVAALRSWV 249
            ..:....||:
Mouse   246 TKLIKFTSWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 70/240 (29%)
Klk1b27NP_064664.1 Tryp_SPc 24..255 CDD:214473 70/240 (29%)
Tryp_SPc 25..258 CDD:238113 70/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.