DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and Klk1b21

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_011249110.1 Gene:Klk1b21 / 16616 MGIID:892022 Length:296 Species:Mus musculus


Alignment Length:305 Identity:85/305 - (27%)
Similarity:126/305 - (41%) Gaps:74/305 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVI 66
            ::|:||.  :|.:||..   ...|.:..|||||.....:|.||.:::.|...:.|||.:.:.|.:
Mouse     1 MRFLILF--LALSLGEI---DAAPPVQSRIVGGFNCEKNSQPWHVAVFRYNKYICGGVLLNPNWV 60

  Fly    67 VTAAHCLQSVSASVLQIRAGSSY--WSSGGVTFS---------VSSFKNHEGYNANTM------- 113
            :|||||..:         |.|.|  |......|.         ||....|..||.:.|       
Mouse    61 LTAAHCYGN---------ATSQYNVWLGKNKLFQHESSAQHRLVSKSFPHPDYNMSLMNDHTPHP 116

  Fly   114 ----VNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGT------------------- 155
                .||:.:::::.....:..:|.|.|.:..|..|:....||||:                   
Mouse   117 EDDYSNDLMLLRLSKPADITDAVKPIDLPTEEPKLGSTCLASGWGSITPTKCESAPRNIARCRGG 181

  Fly   156 ------------LSYGSS-SIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA--ASGKDA 205
                        ||..|: .||:.||...:..:....||.:   |..::...|:||.  ..|||.
Mouse   182 AEGPGLGPVHHPLSLSSTGQIPNDLQCGFIKPLPNENCAKA---YIHKVTDVMLCAGEMGGGKDT 243

  Fly   206 CQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVAALRSWV 249
            |.|||||||:..|||.|:.||| ..||..|.|.:|..:....||:
Mouse   244 CAGDSGGPLICDGVLQGITSWGSIPCAKPNAPAIYTKLIKFTSWI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 77/275 (28%)
Klk1b21XP_011249110.1 Tryp_SPc 25..291 CDD:238113 77/276 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.