DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG43742

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:292 Identity:75/292 - (25%)
Similarity:114/292 - (39%) Gaps:85/292 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVILLSAVAC---ALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNV 65
            |.:||.||..   |....:.|....::..|:..|.....|.|  ..:|..:....||||:.....
  Fly     5 FSLLLVAVVIYQNAFAQLLDENCKVKITYRVANGHTAITSQF--MAALYNNSEFFCGGSLIHKQY 67

  Fly    66 IVTAAHCLQS------------------VSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANT 112
            ::|||||::.                  |...||::.|               ....|..::.|.
  Fly    68 VLTAAHCVRDLDEVTVHLGENNRSCPIPVCKHVLRLNA---------------KVILHPNFHGNI 117

  Fly   113 MVNDIAIIKINGALTFSSTIKAIGL-----ASSNPANGAAASVSGWGTLSYGSSS---------- 162
            .:||||::::...:.|.:.|:.|.:     .:||..|...|  .|||...:|:.|          
  Fly   118 FLNDIALLRLEREVIFEAHIRPICIILDEDVTSNNQNNFTA--YGWGKTEHGNISDVLSFIDLVR 180

  Fly   163 IPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASGKDACQGDSGGPLV--------SGGV 219
            :|..:.|.|:|.:    ||.||.|                 |.|:.||||||:        |..:
  Fly   181 LPKSMCYQNINTI----CAGSTSG-----------------DTCESDSGGPLIGNFVHRGKSRDI 224

  Fly   220 LVGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
            |.|:.|:| ....|...|||.||.|.:||:.|
  Fly   225 LFGITSYG-DAECSGLFGVYTDVNAYKSWIAS 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 66/259 (25%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 66/259 (25%)
Tryp_SPc 35..256 CDD:238113 67/262 (26%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.