DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP001198

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_321961.2 Gene:AgaP_AGAP001198 / 1281971 VectorBaseID:AGAP001198 Length:260 Species:Anopheles gambiae


Alignment Length:270 Identity:80/270 - (29%)
Similarity:132/270 - (48%) Gaps:42/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTV-PEGLLPQLDGRIVGGSATTISSFPWQISLQ---RSGS---HSCGGS 59
            |.|:|:.:.:  |||.:: |.         |:.|:...:..||:|:|||   .:||   |.|.||
Mosquito     4 LAFIIIPALI--ALGHSIRPP---------IIEGTEANLHEFPYQVSLQWNFNNGSRARHFCSGS 57

  Fly    60 IYSSNVIVTAAHCLQ--------SVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVND 116
            |.:...|:||||||:        .|.|.|..|    ::..:|....:|:.::.||.|:.:.:..|
Mosquito    58 IINQRWILTAAHCLEEYTKDGWFEVVAGVNNI----AHEEAGAQRRNVTRYEQHESYDLSAIRYD 118

  Fly   117 IAIIKINGALTFSSTIKAIGLASSNP-ANGAAASVSGWGTLSYGSSSI-PSQLQYVNVNIVSQSQ 179
            |.:::::..|..:..||.:.||:.:. .:...|..:|||::|.....| |.:|..||:.:.::..
Mosquito   119 IGVLQLSHPLDLTRNIKTMRLATKDTLIHQKIAKFAGWGSISKTWEDIYPDKLMKVNLILRTEED 183

  Fly   180 CASSTYGYGSQIRSTMICAAA-SGKDACQGDSGGPL---VSGGVL-VGVVSWGYGCAYSNYPGVY 239
            |  .|.|   :|..|.|||.. .....|..||||||   :.|..: :||:|:|.....:..|.||
Mosquito   184 C--QTIG---KIDETQICAGGYKNVSGCTADSGGPLTVTIDGEQMQIGVLSYGEKPCQARLPIVY 243

  Fly   240 ADVAALRSWV 249
            :.|.....|:
Mosquito   244 SSVMYFHDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 72/239 (30%)
AgaP_AGAP001198XP_321961.2 Tryp_SPc 23..255 CDD:238113 73/240 (30%)
Tryp_SPc 23..253 CDD:214473 72/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.