DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP001246

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_321901.4 Gene:AgaP_AGAP001246 / 1281921 VectorBaseID:AGAP001246 Length:283 Species:Anopheles gambiae


Alignment Length:236 Identity:88/236 - (37%)
Similarity:130/236 - (55%) Gaps:13/236 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASV--LQIRAGSS 88
            :..||||||:..| ...|:.:||:.||.|.||.||.::...::|||| ||..:.|  |.:.||.:
Mosquito    51 KFSGRIVGGTELT-EPLPYLLSLRDSGFHICGASIINAKHALSAAHC-QSPPSDVNRLTLLAGIT 113

  Fly    89 YWS--SGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASS--NPANGAAAS 149
            ..:  :.|:.|.|::...|..::..|.::|:|||:|..:......:.||.|.|:  .....:.||
Mosquito   114 KRTDETNGILFKVANVTTHPDFSLKTYLSDVAIIRIVTSFLDHPNLAAIPLISTTYKLRVSSVAS 178

  Fly   150 VSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASGKDACQGDSGGPL 214
            |||||..:..|...|: |:.|.:.|||.|.|.:.....  .|..|.|||...|:|:|.|||||||
Mosquito   179 VSGWGLTAQDSMLAPT-LRTVRIPIVSYSSCVNKWRPV--PIVWTAICAGHPGRDSCNGDSGGPL 240

  Fly   215 VSGGVLVGVVSWGYGCAYSNYPGVYADVA--ALRSWVISNA 253
            |..||.:|:||||.....|:|||:|..|.  .:|.::..|:
Mosquito   241 VQDGVQIGLVSWGADRCGSDYPGIYTYVGNKNIRKFIEENS 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 86/226 (38%)
AgaP_AGAP001246XP_321901.4 Tryp_SPc 55..270 CDD:214473 85/219 (39%)
Tryp_SPc 56..270 CDD:238113 84/218 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.