DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP001395

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_321740.5 Gene:AgaP_AGAP001395 / 1281782 VectorBaseID:AGAP001395 Length:268 Species:Anopheles gambiae


Alignment Length:266 Identity:87/266 - (32%)
Similarity:128/266 - (48%) Gaps:38/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVL- 81
            :||.|...|   |||||..:......:..||.:.|.|.||.||.:...::||.||:.|....:| 
Mosquito     2 SVPCGSQQQ---RIVGGVNSNRGQITYIASLTKRGGHFCGASIVNDRWLLTAGHCVCSGVNKILR 63

  Fly    82 --QIRA---------------GSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFS 129
              ||:|               .|..:|.......:.:...|.||..|...||||::::...:.||
Mosquito    64 ANQIQAVLGLYRRSEFGGNQIDSDPFSDRAYEVGIRTIVPHPGYVCNKPSNDIALLELARRIDFS 128

  Fly   130 STIKAIGLAS----SNPANGAAASVSGWG----TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYG 186
            ::::.|.|:|    |....|..|.|:|||    ..:.|..:  ..||...|::....:| .|.|.
Mosquito   129 ASVRPICLSSGADGSARVEGQTAVVAGWGWQQENRNLGDKA--DTLQRAVVDVFRNEEC-ESMYR 190

  Fly   187 YGSQIRS---TMICA--AASGKDACQGDSGGPLV-SGGVLVGVVSWGYGCAYSNYPGVYADVAAL 245
            .|::.|:   |.:||  ...|.|||..||||||| |..||:|:||.|.|||...:||:|..|:..
Mosquito   191 RGNRSRTIARTQLCAGKGTGGVDACWADSGGPLVTSDNVLIGIVSTGIGCARPGFPGIYTRVSEY 255

  Fly   246 RSWVIS 251
            .||:::
Mosquito   256 ASWIVT 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 82/250 (33%)
AgaP_AGAP001395XP_321740.5 Tryp_SPc 11..259 CDD:214473 82/250 (33%)
Tryp_SPc 12..259 CDD:238113 81/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.