DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CLIPA4

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_552464.1 Gene:CLIPA4 / 1280862 VectorBaseID:AGAP011780 Length:422 Species:Anopheles gambiae


Alignment Length:258 Identity:73/258 - (28%)
Similarity:119/258 - (46%) Gaps:45/258 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTIS----------SFPWQISL--QRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQ 82
            |.:||...|::          .|||.:::  .:.||.:||||:...|:::|.|||:|......|:
Mosquito   146 RNIGGIDFTLTGNFNNEAGFGEFPWTVAIIKTQDGSSTCGGSLIHPNLVLTGAHCVQGFRKGQLK 210

  Fly    83 IRAGSSYWSSGGV-------TFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASS 140
            :|||.  |.:...       ..:|:...:|..:|..::.||||:::::..:..:..|..:.|...
Mosquito   211 VRAGE--WDTQTTKERLPYQERAVTRVNSHPDFNPRSLANDIAVLELDSPIQPAEHINVVCLPPV 273

  Fly   141 N-PANGAAASVSGWGTLSYGSSSIPSQ-LQYVNVNIVSQSQC--------ASSTYGYGSQIRSTM 195
            | .........||||...:|.:...|. ::.|.:.:|..|.|        .:|.:    ::..|.
Mosquito   274 NFDTRRTDCFASGWGKDQFGKAGRYSVIMKKVPLPLVPSSTCERQLQATRLTSRF----RLHQTF 334

  Fly   196 ICAAAS-GKDACQGDSGGPLV--------SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |||... |.|.|:||.|.|||        :....||.|:||.|| :...||||.:|...|||:
Mosquito   335 ICAGGERGVDTCEGDGGAPLVCPIGAASENRYAQVGSVAWGIGC-HDAVPGVYTNVILFRSWI 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 72/256 (28%)
CLIPA4XP_552464.1 Tryp_SPc 161..399 CDD:238113 69/243 (28%)
Tryp_SPc 161..396 CDD:214473 68/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.