DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP011912

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_320615.4 Gene:AgaP_AGAP011912 / 1280750 VectorBaseID:AGAP011912 Length:408 Species:Anopheles gambiae


Alignment Length:264 Identity:86/264 - (32%)
Similarity:133/264 - (50%) Gaps:36/264 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHS--CGGSIYSSNVIVT 68
            ::..|..|:.|        .:...:||.|..|.::.||....|..|.|.|  ||.:|.|....:|
Mosquito   153 VVAQAPKCSCG--------LRRTSKIVNGVPTLVNEFPMMAGLVDSSSRSVFCGATIISDYHSIT 209

  Fly    69 AAHCLQSVSASVLQIRAGSSYWSSG-----GVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTF 128
            ||||::..|.|...:..|....|.|     .|...::|..||..|..:...||||:::....:.|
Mosquito   210 AAHCMRGRSLSASGLLVGDHNLSVGTDTSYSVLMRLASITNHPQYVVSPSRNDIALVRTADRIAF 274

  Fly   129 SSTIKAIGLA-------SSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYG 186
            ::   |:|.|       :||.| |:....:||||:.:|:.: .:.|:.|::|::|:..|.||.  
Mosquito   275 NA---AVGPACLPFRYSTSNFA-GSIVEATGWGTMDFGAPT-SNVLRKVSLNVISEQSCQSSM-- 332

  Fly   187 YGSQIRSTMICAAASGKDACQGDSGGPLV--SGG--VLVGVVSWGYGCAYSNYPGVYADVAALRS 247
              ..|.::.||....|||.||.||||||:  :||  .|||||::|..|| |:.|.|.:.:.:..|
Mosquito   333 --PNILASHICTYTPGKDTCQYDSGGPLLFTTGGRVYLVGVVNYGVSCA-SSKPSVSSRITSYLS 394

  Fly   248 WVIS 251
            |:.|
Mosquito   395 WIQS 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 81/236 (34%)
AgaP_AGAP011912XP_320615.4 CUB 55..155 CDD:238001 0/1 (0%)
Tryp_SPc 169..396 CDD:214473 81/236 (34%)
Tryp_SPc 170..399 CDD:238113 83/239 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.