DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP009211

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_319989.4 Gene:AgaP_AGAP009211 / 1280170 VectorBaseID:AGAP009211 Length:265 Species:Anopheles gambiae


Alignment Length:265 Identity:74/265 - (27%)
Similarity:111/265 - (41%) Gaps:54/265 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IVGGSATTISSFPWQISLQRSGSHS--CGGSIYSSNVIVTAAHCLQS---------------VSA 78
            |..|......:|||...|:.|.|..  ||||:.|...|:|||||:::               ..:
Mosquito     9 IAYGQPARAYAFPWMALLETSVSDDLPCGGSLISDRHILTAAHCVKARKRDCDDRIHFKDDEYDS 73

  Fly    79 SVLQIRAGSSYWSSGG---VTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAI----- 135
            ...:...|:.|.:|.|   ....:.:...|..|:|.:..||:|||::.........:..|     
Mosquito    74 GESEEADGAEYSASCGPPAQRIPIETIVTHPKYSARSKRNDLAIIRLQYPAIIGYNVIPICLPLT 138

  Fly   136 -GLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRST----- 194
             .|.:..||:   :.|:|||....|..|  :.|:|..:..:....||       .:|:..     
Mosquito   139 EQLRAYRPAD---SFVTGWGLTETGQRS--AVLRYAILPALPLPDCA-------MRIKELDRIIV 191

  Fly   195 ----MICAAASGKDA-CQGDSGGPL--VSGG---VLVGVVSWGY-GCAYSNYPGVYADVAALRSW 248
                .:||..:.:.| |.|||||||  ||..   ||.||||:|. .|.....|||:|:|.....|
Mosquito   192 LDDGHLCAGGNNRTAHCHGDSGGPLQYVSDSTRFVLQGVVSFGVKTCGTKIAPGVFANVTHFIDW 256

  Fly   249 VISNA 253
            ::..|
Mosquito   257 IVQEA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 72/259 (28%)
AgaP_AGAP009211XP_319989.4 Tryp_SPc 9..257 CDD:214473 72/259 (28%)
Tryp_SPc 9..257 CDD:238113 72/259 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.