DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and CG43336

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:281 Identity:71/281 - (25%)
Similarity:119/281 - (42%) Gaps:71/281 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRS-GSHSCGGSIYSSNVIVTAAHCLQ 74
            :||.:....|.  :|    |:..|:..:::|.||...|..: |...||||:.::.:::|||||. 
  Fly    24 MACGIRAHSPS--VP----RVKNGTVASLTSSPWMAFLHSTDGRFICGGSLITNRLVLTAAHCF- 81

  Fly    75 SVSASVLQIRAG-----------SSYWSSGGVTFSVSSFK----NHEGYNANTMVNDIAIIKING 124
             :..:.|..|.|           .||     .|:.:.:..    .|..||..||..||||:::..
  Fly    82 -LDRTELVARLGEYDREEYEMCHDSY-----CTYRIEAMVERGFRHRHYNPMTMAYDIAILRLYR 140

  Fly   125 ALTFSSTIKAIGLA----------SSNPANGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQS 178
            .:.::..|:.|.:.          |.:|..|     :||| |.|.|.|   ::|:.|::......
  Fly   141 KVQYTDNIRPICIVIDPRWRKYIDSLDPLTG-----TGWGKTESEGDS---AKLRTVDLARKHPE 197

  Fly   179 QCASSTYGYGS-QIRSTMICAAASGKDACQGDSGGP---LVSGG-----VLVGVVSWGYGCAYSN 234
            .|..    |.: .:.:...||.....:.|.||||||   |:..|     |.||:.|      ::|
  Fly   198 VCRR----YATLSLTANQFCAGNERSNLCNGDSGGPVGALIPYGKSKRFVQVGIAS------FTN 252

  Fly   235 ----YPGVYADVAALRSWVIS 251
                ...|:.||.:...|:::
  Fly   253 TQCVMVSVFTDVMSYVDWILA 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 66/258 (26%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 66/258 (26%)
Tryp_SPc 40..271 CDD:238113 65/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
21.910

Return to query results.
Submit another query.