DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP004770

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_318046.3 Gene:AgaP_AGAP004770 / 1278456 VectorBaseID:AGAP004770 Length:259 Species:Anopheles gambiae


Alignment Length:255 Identity:87/255 - (34%)
Similarity:139/255 - (54%) Gaps:8/255 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNV 65
            |.:.:.::..::|:.....|..:|.:...|||||....|.:.|:|.|:|..|.|.|||||.....
Mosquito     1 MNELLAIMCMLSCSSVLEPPVSILNETTQRIVGGHEIDIGAAPFQASVQSHGVHVCGGSIIHQQW 65

  Fly    66 IVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVN-DIAIIKINGALTFS 129
            :::|.|| .|...:.|.:|..|.:.:.||...:|.....|..|:...::: |::::::...||||
Mosquito    66 VLSAGHC-SSKEPNSLSVRVASIHHNQGGQIVNVEESIRHPLYDEQLIIDYDVSLLRLEQCLTFS 129

  Fly   130 STIKAIGLASSNP--ANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIR 192
            ..::||.|...:.  .:|....|||||.......| ..:|:..:|.:|:.:.|.::.....:.|.
Mosquito   130 PNVQAIRLPMQDEFFQDGTVCVVSGWGATQNPVES-SDRLRATDVPLVNHAVCQTAYISAAATIT 193

  Fly   193 STMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYG-CAYSNYPGVYADVAALRSWV 249
            ..||||.  :.|:|||||||||||.....|:|||||..| ||..|:||||:.||::|:|:
Mosquito   194 DRMICAGYFSGGRDACQGDSGGPLYYENTLIGVVSWRTGDCAEVNFPGVYSRVASVRAWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 82/224 (37%)
AgaP_AGAP004770XP_318046.3 Tryp_SPc 30..253 CDD:214473 82/224 (37%)
Tryp_SPc 31..256 CDD:238113 82/225 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.