DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and TRY6_ANOGA

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_317175.2 Gene:TRY6_ANOGA / 1277692 VectorBaseID:AGAP008290 Length:273 Species:Anopheles gambiae


Alignment Length:266 Identity:100/266 - (37%)
Similarity:141/266 - (53%) Gaps:21/266 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KFVILLSAV-----ACALGGTVPEGLL---------PQLDG-RIVGGSATTISSFPWQISLQRSG 52
            ||..:|.||     ||||........|         |.|.| |||||....||..|:|||||.:|
Mosquito     4 KFTAILLAVHIALFACALTQAEKRHKLTRPAFHPNAPYLAGKRIVGGFVIDISDAPYQISLQYNG 68

  Fly    53 SHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDI 117
            .|.|||||.:|..|:|||||:...|.....:|.|||..::||....:.....|.|:::.....||
Mosquito    69 KHHCGGSILNSKWILTAAHCIDLYSEVKPTVRVGSSEHAAGGTVLHLLRIVPHPGHSSGGNNYDI 133

  Fly   118 AIIKINGALTFSSTIKAIGLASSNPA--NGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQC 180
            |::::...|||:..::.:.|...:..  .|....||||| ::..::.:.:.|:..||..|:|.:|
Mosquito   134 ALLELECELTFNDNVQPVQLPEQDDPIDEGTMGIVSGWG-MTMSAADLNAILRATNVPTVNQQEC 197

  Fly   181 ASSTYGYGSQIRSTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVA 243
            ..:...||. :...|.||.  ..|...|:.|||||.|:.|.|:|||||.:.||.:.||||||.||
Mosquito   198 NQAYQSYGG-VAEQMFCAGYKQGGTGTCRNDSGGPFVAEGKLIGVVSWSHECALAGYPGVYARVA 261

  Fly   244 ALRSWV 249
            ::|.|:
Mosquito   262 SVRDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 86/222 (39%)
TRY6_ANOGAXP_317175.2 Tryp_SPc 46..267 CDD:214473 86/222 (39%)
Tryp_SPc 47..270 CDD:238113 86/223 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.