DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and TRY5_ANOGA

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_317174.2 Gene:TRY5_ANOGA / 1277691 VectorBaseID:AGAP008291 Length:274 Species:Anopheles gambiae


Alignment Length:234 Identity:100/234 - (42%)
Similarity:131/234 - (55%) Gaps:15/234 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLDG-RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSS 88
            |.|.| |||||....||..|:|||||....|:|||||.||..|:|||||:...:.|...:|.|||
Mosquito    41 PYLAGKRIVGGFVINISDAPYQISLQYDDDHNCGGSILSSKWILTAAHCINDNAPSKPTVRVGSS 105

  Fly    89 YWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNP--ANGAAASVS 151
            ..:|||....|:....|..:.:.... |||::::...||||..::.|.|...:.  ..|....||
Mosquito   106 KHASGGTVIRVARIVPHPMHGSKNNY-DIALLELKNELTFSEKVQPIALPEQDEPIEEGTMGIVS 169

  Fly   152 GWG-TLSYGSSSIPSQLQYVNVNIVSQSQC---ASSTYGYGSQIRSTMICAA--ASGKDACQGDS 210
            ||| |||...|:  ..|:..||..|:|.:|   ..|.||   .|...|.||.  ..|:|.|:.||
Mosquito   170 GWGLTLSEADSN--DVLRATNVPTVNQQECNKAYQSRYG---GITDQMFCAGYKQGGQDTCRQDS 229

  Fly   211 GGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            |||.|:.|.|:||:|||:.||.:.||||||.||::|.|:
Mosquito   230 GGPFVAKGKLIGVISWGHECALAGYPGVYARVASVRDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 96/226 (42%)
TRY5_ANOGAXP_317174.2 Tryp_SPc 47..268 CDD:214473 96/226 (42%)
Tryp_SPc 48..271 CDD:238113 96/227 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.