DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and TRY4_ANOGA

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_317173.2 Gene:TRY4_ANOGA / 1277690 VectorBaseID:AGAP008292 Length:275 Species:Anopheles gambiae


Alignment Length:263 Identity:109/263 - (41%)
Similarity:146/263 - (55%) Gaps:23/263 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAVACALGGT-----VPEGL---LPQ-----LDGRIVGGSATTISSFPWQISLQRSGSHSCG 57
            :||:.||||....     ||..|   ||:     .:.|||||....::..|:|:|||||..|.||
Mosquito    11 VLLAVVACAQAHASHQRRVPYPLPRFLPRPHHTVSNHRIVGGFEIDVAETPYQVSLQRSKRHICG 75

  Fly    58 GSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKI 122
            ||:.|...|:|||||......:.|.:|.|||..:|||....|:....|..|:..|:..|.:::::
Mosquito    76 GSVLSGKWILTAAHCTDGSQPASLTVRLGSSRHASGGSVIHVARIVQHPDYDQETIDYDYSLLEL 140

  Fly   123 NGALTFSSTIKAIGLASSNPA--NGAAASVSGWGTLSYGSSSIPSQ--LQYVNVNIVSQSQCASS 183
            ...||||:.::.|.|...:.|  :|....|||||:.   .|:|.|.  |:..||..|:|.:| :.
Mosquito   141 ESVLTFSNKVQPIALPEQDEAVEDGIMTIVSGWGST---KSAIESNAILRAANVPTVNQDEC-NQ 201

  Fly   184 TYGYGSQIRSTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALR 246
            .|.....|...|:||.  ..||||||||||||||:...|:||||||.|||...||||||.||.:|
Mosquito   202 AYHKSEGITERMLCAGYQQGGKDACQGDSGGPLVAEDKLIGVVSWGAGCAQPGYPGVYARVAVVR 266

  Fly   247 SWV 249
            .|:
Mosquito   267 DWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 97/224 (43%)
TRY4_ANOGAXP_317173.2 Tryp_SPc 48..269 CDD:214473 97/224 (43%)
Tryp_SPc 49..272 CDD:238113 97/225 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.