DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and TRY1_ANOGA

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_317170.2 Gene:TRY1_ANOGA / 1277688 VectorBaseID:AGAP008296 Length:274 Species:Anopheles gambiae


Alignment Length:264 Identity:103/264 - (39%)
Similarity:151/264 - (57%) Gaps:18/264 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAVACALGGTVPEGLLPQ------------LDGRIVGGSATTISSFPWQISLQRSGSHSCGG 58
            :|::.||||.........|.:            :..|||||....:|..|:|:|||.:..|:|||
Mosquito    11 VLVAVVACAEAQANQRHRLVRPSPSFSPRPRYAVGQRIVGGFEIDVSDAPYQVSLQYNKRHNCGG 75

  Fly    59 SIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKIN 123
            |:.||..::|||||....|.|.|.:|.|:|..:|||....|:....|..|:::::..|.:::::.
Mosquito    76 SVLSSKWVLTAAHCTAGASPSSLTVRLGTSRHASGGTVVRVARVVQHPKYDSSSIDFDYSLLELE 140

  Fly   124 GALTFSSTIKAIGLASSNPA--NGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYG 186
            ..||||.:::.:||...:..  :|...:|||||.....:.| .:.|:..||..|:|.:|..:...
Mosquito   141 DELTFSDSVQPVGLPKQDETVKDGTMTTVSGWGNTQSAAES-NAVLRAANVPTVNQKECNKAYSE 204

  Fly   187 YGSQIRSTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            :|. :...|:||.  ..||||||||||||||:.|.||||||||||||.:.|||||:.||.:|.||
Mosquito   205 FGG-VTDRMLCAGYQQGGKDACQGDSGGPLVADGKLVGVVSWGYGCAQAGYPGVYSRVAVVRDWV 268

  Fly   250 ISNA 253
            ..|:
Mosquito   269 RENS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 94/222 (42%)
TRY1_ANOGAXP_317170.2 Tryp_SPc 47..268 CDD:214473 94/222 (42%)
Tryp_SPc 48..271 CDD:238113 95/224 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.