DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP006672

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_316708.4 Gene:AgaP_AGAP006672 / 1277262 VectorBaseID:AGAP006672 Length:327 Species:Anopheles gambiae


Alignment Length:275 Identity:91/275 - (33%)
Similarity:134/275 - (48%) Gaps:42/275 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSAVACALGGTVPEGLLPQLD-GRIVGGSATTISSFPWQIS---LQRSGSHS-CGGSIYSSNVI 66
            :|||.:.||  ..|:.::.:.. .::.||:......||..:|   :...||.: |||||.:...|
Mosquito    57 ILSAASTAL--YRPKLIIDRASLSKVAGGTVAKNDQFPHLVSIILIFADGSDTLCGGSILADRFI 119

  Fly    67 VTAAHCLQSV-------SASVLQIRAGSSYWSSGGVTFSVSSFKN--HEGYNANTMVNDIAIIKI 122
            :||||||..:       ..||:||.     :....||.::.....  |.||:...::||||:|::
Mosquito   120 LTAAHCLYGMQEATIVPGQSVIQIP-----FPPDIVTVAIKPADTILHPGYDPVDILNDIALIRL 179

  Fly   123 NGALTFSSTIKAIGLASSNPA----NGAAASVSGWGTLS---YGS--SSIPSQLQYVNVNIVSQS 178
            ...||||:.::.|.|.|...:    .|..:.|||||..|   |..  ..:...|::....||..:
Mosquito   180 PQPLTFSARVQPIRLPSWTNSYVDLTGYDSIVSGWGAQSNDDYAELVDEMRLDLRFATNTIVPNA 244

  Fly   179 QCASSTYGYGSQIRSTMICAAA-SGKDACQGDSGGPLV---SGGVL--VGVVSWG--YGCAYSNY 235
            .|...   |||.||...||.|. .|::.|||||||||.   .|..|  ||:||:|  .||. :..
Mosquito   245 VCHRV---YGSIIRDQQICVAGEGGRNPCQGDSGGPLTVKFDGQRLTQVGIVSYGSVLGCE-NGV 305

  Fly   236 PGVYADVAALRSWVI 250
            ||||..|::...|::
Mosquito   306 PGVYTRVSSYVEWIV 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 84/248 (34%)
AgaP_AGAP006672XP_316708.4 Tryp_SPc 79..319 CDD:214473 84/248 (34%)
Tryp_SPc 80..319 CDD:238113 84/247 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.