DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP006385

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_316419.4 Gene:AgaP_AGAP006385 / 1276997 VectorBaseID:AGAP006385 Length:260 Species:Anopheles gambiae


Alignment Length:258 Identity:77/258 - (29%)
Similarity:126/258 - (48%) Gaps:25/258 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQ---RSGSHS-CGGSIYSSNVI 66
            :.|.|:..::....|.|.:     |:|.|....:..||:|:.|.   .:|..: ||||:.:...:
Mosquito     8 LALLALVASVAQAAPRGGM-----RVVNGETAKLGQFPYQVRLTLHVGNGQQALCGGSLLNEEWV 67

  Fly    67 VTAAHCLQSVSASVLQIRAG----SSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALT 127
            :||.||:  :.|..:::..|    |...:.|.:....:.|..||.||...:.||:|::|:...:.
Mosquito    68 LTAGHCV--MLAKSVEVHLGAVDFSDNTNDGRLVLESTEFFKHEKYNPLFVANDVALVKLPSKVE 130

  Fly   128 FSSTIKAIGLASSN-PANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQI 191
            ||..::.:.|.:.: ...|....|||||.:..| ..:..:|||..:.::...|| ..|:. ...:
Mosquito   131 FSERVQPVRLPTGDEDFAGREVVVSGWGLMVNG-GQVAQELQYATLKVIPNKQC-QKTFS-PLLV 192

  Fly   192 RSTMICAAASG-KDACQGDSGGPLV--SGGVLVGVVSWGY--GCAYSNYPGVYADVAALRSWV 249
            |.:.:||.... :..|.||||||||  ....||||||:|:  ||. ..:|..:|.|.|.|.||
Mosquito   193 RKSTLCAVGEELRSPCNGDSGGPLVLAEDKTLVGVVSFGHAQGCD-KGHPAAFARVTAFRDWV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 71/232 (31%)
AgaP_AGAP006385XP_316419.4 Tryp_SPc 27..254 CDD:214473 71/232 (31%)
Tryp_SPc 28..257 CDD:238113 72/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.