DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP006120

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_316180.4 Gene:AgaP_AGAP006120 / 1276790 VectorBaseID:AGAP006120 Length:899 Species:Anopheles gambiae


Alignment Length:238 Identity:74/238 - (31%)
Similarity:109/238 - (45%) Gaps:22/238 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQIS-LQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGS-SYWSS 92
            ||:||..:....:|||:: |.|.....|||::.||..|:|||||::    ..|.:|.|. :...|
Mosquito   658 RIIGGKTSRRGQWPWQVAILNRFKEAFCGGTLVSSRWILTAAHCVR----KRLFVRLGEHNLQQS 718

  Fly    93 GG--VTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPA--NGAAASVSGW 153
            .|  :.|.|.....|..|:..|:.||:|::|:...:..|:.|....|.....|  .|...::.||
Mosquito   719 DGTEIEFRVELSIKHPRYDKKTVDNDVALLKLPREVERSNFIGYSCLPERYQALPTGHTCTIIGW 783

  Fly   154 GTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA-ASGK-DACQGDSGGPLV- 215
            |...:...:....|....|.||...:|.:..:.|  .|...|.||. ..|: |.|.|||||||: 
Mosquito   784 GKKRHNDDAGTDILHEAEVPIVPNERCRAVYHDY--TITKNMFCAGHKRGRIDTCAGDSGGPLLC 846

  Fly   216 -------SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVIS 251
                   |...:.|:.|:|.||...|..|:|..|.....|:.|
Mosquito   847 RDATKLNSPWTIYGITSFGDGCGKQNKFGIYTKVPNYVDWIWS 889

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 72/234 (31%)
AgaP_AGAP006120XP_316180.4 Tryp_SPc 658..887 CDD:214473 72/234 (31%)
Tryp_SPc 659..887 CDD:238113 71/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.