DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP006087

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_316143.4 Gene:AgaP_AGAP006087 / 1276758 VectorBaseID:AGAP006087 Length:342 Species:Anopheles gambiae


Alignment Length:250 Identity:77/250 - (30%)
Similarity:125/250 - (50%) Gaps:36/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LDGRIVGGSATTISSFPWQISL------QRSGSHS---CGGSIYSSNVIVTAAHCLQSVSASVLQ 82
            |..|||||........|:.:||      :|.|..|   ||||:.:::.::||:||..:..::::.
Mosquito    59 LGERIVGGRNALYGDAPFHVSLRSLYHERRHGFGSGLFCGGSLITASRVLTASHCFTTKPSNMVV 123

  Fly    83 IRAGSSYWSSGGV--TFS---------VSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIG 136
            :         .||  .|.         |..:.:|.|::|.|:..||.::.:.........::.|.
Mosquito   124 V---------AGVLNRFDRSKRMQQRRVLRYLSHPGWHARTLAADIGLVALVSPFQCGGGVQPIA 179

  Fly   137 LASSNPANGAAASVSGWGTLSYGSSS--IPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA 199
            ||:..|.:|...::.|||....|...  .|..||..:|:::...:|..|.:...: :....:||.
Mosquito   180 LANRPPVDGEPCTIYGWGQTEEGRKQRFQPVCLQKASVSVLGLERCNRSLHTVVT-VPDGTLCAG 243

  Fly   200 A--SGKDACQGDSGGPLV--SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVI 250
            :  .|.|:||||||||||  .||.|.|:||:|:||..:|:||||.||...|.|::
Mosquito   244 SFDGGVDSCQGDSGGPLVCGGGGALYGIVSFGWGCGRANFPGVYTDVFQYRGWIV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 75/244 (31%)
AgaP_AGAP006087XP_316143.4 Tryp_SPc 62..297 CDD:214473 75/244 (31%)
Tryp_SPc 63..297 CDD:238113 74/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.