DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP005792

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_315805.4 Gene:AgaP_AGAP005792 / 1276458 VectorBaseID:AGAP005792 Length:251 Species:Anopheles gambiae


Alignment Length:228 Identity:48/228 - (21%)
Similarity:101/228 - (44%) Gaps:21/228 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVT 96
            :||..|.|..:|:..:::.:......|:|.:...|:|:|..:.....|:.:::.|::.:...|..
Mosquito    27 IGGKDTGIFLYPYMAAIEFAQKLVGNGAIVAQRYILTSASAVAEPHDSLYKVQLGANVFKGPGDL 91

  Fly    97 FSVSSFKNHE---GYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSY 158
            :.|.:...|.   |::.|     ||::.:...:.:|.:::...:|.:..:|.....|| :||...
Mosquito    92 YEVLTIYKHPQYIGWDYN-----IALLHLKDPIRYSDSVQPAIIADTFVSNLQVLLVS-YGTNED 150

  Fly   159 GSSSIPSQLQYVNVNIVSQSQCASS-TYGYGSQ--IRSTMICAAASGKDACQG----DSGGPLVS 216
            |:..:...:...:..    ::|..| |.|...:  |:....| ..|...|.||    |:|.|:|:
Mosquito   151 GTMHLREAIYTTSTG----AECVDSLTRGLSKEIIIQEHGFC-VRSPPGAEQGQWADDAGAPIVA 210

  Fly   217 GGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            .|.|.||.::......:|...:...|::...|:
Mosquito   211 DGKLYGVFAFSEQEGKTNVGSIGTRVSSFLEWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 47/226 (21%)
AgaP_AGAP005792XP_315805.4 Tryp_SPc 27..246 CDD:304450 48/228 (21%)
Tryp_SPc 27..243 CDD:214473 47/226 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.