DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP005704

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_315712.4 Gene:AgaP_AGAP005704 / 1276373 VectorBaseID:AGAP005704 Length:305 Species:Anopheles gambiae


Alignment Length:253 Identity:62/253 - (24%)
Similarity:112/253 - (44%) Gaps:27/253 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TVPEGLLPQLDGRIVGGSATTISSFPWQISL---QRSGSHSCGGSIYSSNVIVTAAHCLQSVSAS 79
            ::.||  |....||:.|........|:..::   :...::.|||.:.|...::|||.|::.....
Mosquito    51 SLSEG--PNRSQRILNGVTVARGDIPYAAAILISEEFATYFCGGVLVSELFVLTAASCVEGDRDL 113

  Fly    80 VLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPAN 144
            .:.:...::..::.|...:||....|...:.    ||||::::|.|:..:..|:.:.|.:.....
Mosquito   114 SITVLLDAAQINTAGEFIAVSEIIVHPAPSD----NDIALLRLNRAVRLNDNIRPVTLPNRRQRT 174

  Fly   145 ----GAAASVSGWG-TLSYGSSSIP-SQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASGK 203
                ...||:|||| |.|..:.::| :.|:.|..:::|...|..|   :...|....||......
Mosquito   175 MTFVNQLASISGWGRTASNTNEALPLNNLRLVRNHVMSNFNCGVS---FPFTITDQHICITGDSG 236

  Fly   204 DACQGDSGGPLVSGGV------LVGVVSWG--YGCAYSNYPGVYADVAALRSWVISNA 253
            .||.||.||||.:..|      |:|:.|:.  .||.... |.|:..:.....|:.:|:
Mosquito   237 SACAGDEGGPLTTVDVVTGRTFLIGLYSFTSFLGCGMGR-PTVHTRITEYLDWIEANS 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 57/235 (24%)
AgaP_AGAP005704XP_315712.4 Tryp_SPc 61..289 CDD:214473 57/235 (24%)
Tryp_SPc 62..292 CDD:238113 57/237 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.