DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and SCRASP1

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_315638.3 Gene:SCRASP1 / 1276311 VectorBaseID:AGAP005625 Length:1322 Species:Anopheles gambiae


Alignment Length:242 Identity:81/242 - (33%)
Similarity:116/242 - (47%) Gaps:22/242 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAG--- 86
            |....|:|.||.|.....|||.||:....|.||..:.:...::||||||.....|..::|.|   
Mosquito  1073 PTYGARVVHGSETVYGHHPWQASLRVKTMHWCGAVLITRYHVLTAAHCLIGYPKSTYRVRIGDYH 1137

  Fly    87 SSYWSSGGVTFSVSSFKNHEGY-NANTMVNDIAIIKINGALTFSSTIKAIGLASSNPAN------ 144
            ::.:.:..:...:.:...||.: ..:.|.||||::.:...:.|:..::.|.|    ||.      
Mosquito  1138 TAAYDNAELDIFIENTYIHEQFREGHHMSNDIAVVVLKTPVRFNDYVQPICL----PARDAPYLP 1198

  Fly   145 GAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAA--SGKDACQ 207
            |...::||||....||......|:...|.::..|.|..... ||..:...|.||..  .|.|:|.
Mosquito  1199 GQNCTISGWGATEAGSKDSSYDLRAGTVPLLPDSVCRRPEV-YGDSLIDGMFCAGTLEPGVDSCD 1262

  Fly   208 GDSGGPLV---SGGV--LVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ||||||||   |.|:  |.|:||||..|.|:|.||||..||..|.|:
Mosquito  1263 GDSGGPLVCPNSEGLHTLTGIVSWGKHCGYANKPGVYLKVAHYRDWI 1309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 79/235 (34%)
SCRASP1XP_315638.3 ChtBD2 181..228 CDD:214696
ChtBD2 289..334 CDD:214696
LDLa 731..762 CDD:238060
SRCR 776..878 CDD:278931
SR 776..877 CDD:214555
LDLa 884..921 CDD:238060
SR 927..1025 CDD:214555
SRCR 932..1025 CDD:278931
Tryp_SPc 1078..1309 CDD:214473 79/235 (34%)
Tryp_SPc 1079..1312 CDD:238113 79/236 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.