DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaTry and AgaP_AGAP005196

DIOPT Version :9

Sequence 1:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_314095.2 Gene:AgaP_AGAP005196 / 1274902 VectorBaseID:AGAP005196 Length:264 Species:Anopheles gambiae


Alignment Length:247 Identity:75/247 - (30%)
Similarity:117/247 - (47%) Gaps:26/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSAVACALGGT-VPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAH 71
            ||.:|..:||| |.:|..|.|.|.:...|||                 .|||||.::..|:||||
Mosquito    29 LSPMALIIGGTDVEDGKAPYLAGLVYNNSAT-----------------YCGGSIIAARWILTAAH 76

  Fly    72 CLQSVSASVLQ-IRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAI 135
            |:.:|:.:.|. :|.|::....||..:.:.....||.|:|.|..||:|::::...:.|...::.|
Mosquito    77 CVTNVNVTNLTVVRVGTNDNYEGGSMYQIDRVIPHERYSAITFRNDVALLRLKTPIKFEEHVEKI 141

  Fly   136 GLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICA-A 199
            .|........|..::.|||.:.:...: |.:.|.:.|..:..::|..  ...||.|....:|. :
Mosquito   142 ELNEELVPINATLTIVGWGFVGWNKEN-PKRTQVIKVQHIGLNRCRK--MANGSAIYPEHLCTFS 203

  Fly   200 ASGKDACQGDSGGPLVSGGVLVGVVSWGYG--CAYSNYPGVYADVAALRSWV 249
            .:|...|:||||.|:|..|..||||||...  ||. ..|.|.|.:.....|:
Mosquito   204 RAGHGPCKGDSGSPVVWKGKQVGVVSWAMAGVCAI-GLPDVQASIRYFYGWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 63/222 (28%)
AgaP_AGAP005196XP_314095.2 Tryp_SPc 35..257 CDD:238113 72/241 (30%)
Tryp_SPc 35..254 CDD:214473 71/239 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.